PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c1_42920V3.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 509aa    MW: 56368.5 Da    PI: 6.8723
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c1_42920V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.8e-171764148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+W ++Ede+l ++v+++G+g+W+++ ++ g+ R++k+c++rw +yl
  Pp3c1_42920V3.3.p 17 KGAWGADEDEKLRKYVEKYGTGHWRSVGKKAGLQRCGKSCRLRWTNYL 64
                       79********************************************97 PP

2Myb_DNA-binding55.41.4e-1771113246
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        g++++eE++l+v++++ +G++ W++Ia+ ++ gRt++++k++w++
  Pp3c1_42920V3.3.p  71 GSFSEEEEDLIVKLHTSHGSR-WSLIAAQLP-GRTDNDIKNHWNT 113
                        78*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.8191264IPR017930Myb domain
SuperFamilySSF466892.85E-2915111IPR009057Homeodomain-like
SMARTSM007173.1E-131666IPR001005SANT/Myb domain
PfamPF002493.2E-151764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-221871IPR009057Homeodomain-like
CDDcd001675.46E-111964No hitNo description
PROSITE profilePS5129427.2365119IPR017930Myb domain
SMARTSM007172.1E-1569117IPR001005SANT/Myb domain
PfamPF002492.1E-1571113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2572119IPR009057Homeodomain-like
CDDcd001677.52E-1272115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MTRLSKPSAN GINDVRKGAW GADEDEKLRK YVEKYGTGHW RSVGKKAGLQ RCGKSCRLRW  60
TNYLRPDIRH GSFSEEEEDL IVKLHTSHGS RWSLIAAQLP GRTDNDIKNH WNTRLKKKLC  120
DMGIDPVTHK PIAQLLRDLA ETLALSGSAV NSDAVEEAQR CFRDTILNKA VRECGRPLEV  180
QPFSTSQIGM QDYRQPSAGN AGTANHYHLN AHQFEMSANN SDYSRGGEEE SFSGRSPSPT  240
IYSNLNHSAY NRGWSGEQSL QDETLRISEG SYAFPNQLTI PADQTLLRLQ EIATQSVILE  300
PSDCPDVQSA SLLKTSKEDA SSEMSNCNRA LGELFASSSA PFQIRSNQVQ YPEESVWTLG  360
SRPNLSFIQD HNTVPEEELE SSSRVRFGNL QEWNRMAKVP TCRSKNRNFP RNLATTVSKE  420
NLVGYRSIMH TDGASFSPAS SGVGAAGPFQ DILRVNGEFT TSNNTISSFI TSNAAESLGG  480
SCAPAHSELR LNEYEVHVPS TRMVSWDC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28111191108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S295_52V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-60myb domain protein 103